Lineage for d4peqb_ (4peq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098543Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2098544Family c.10.1.1: 28-residue LRR [52048] (3 protein domains)
  6. 2098557Protein automated matches [190173] (3 species)
    not a true protein
  7. 2098558Species Cow (Bos taurus) [TaxId:9913] [257491] (1 PDB entry)
  8. 2098559Domain d4peqb_: 4peq B: [257492]
    Other proteins in same PDB: d4peqa_, d4peqc_
    automated match to d3tsre_

Details for d4peqb_

PDB Entry: 4peq (more details), 2.21 Å

PDB Description: structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease i
PDB Compounds: (B:) Ribonuclease/angiogenin inhibitor 1

SCOPe Domain Sequences for d4peqb_:

Sequence, based on SEQRES records: (download)

>d4peqb_ c.10.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
gdaglrllceglldprcrleklqleycsltaasceplaavlratrdlkelvvsnndigea
gvqalcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdagla
elcpgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllc
esllqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqal
gqpgtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqp
acsleqlvlydiywteavderlraveeskpglriis

Sequence, based on observed residues (ATOM records): (download)

>d4peqb_ c.10.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
gdaglrllceglldrleklqleycsltaasceplaavlratrdlkelvvsnndigeagvq
alcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdaglaelc
pgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllcesl
lqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqalgqp
gtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqpacs
leqlvlydiywteavderlraveeskpglriis

SCOPe Domain Coordinates for d4peqb_:

Click to download the PDB-style file with coordinates for d4peqb_.
(The format of our PDB-style files is described here.)

Timeline for d4peqb_: