Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:349101] [257489] (2 PDB entries) |
Domain d4pe3a_: 4pe3 A: [257490] automated match to d2zzxc_ complexed with act, edo, imd, zn |
PDB Entry: 4pe3 (more details), 1.35 Å
SCOPe Domain Sequences for d4pe3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pe3a_ c.94.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 349101]} hhfrfqssdpagnpnfelqhvfadkvkeltngevtielmpvgtivdyketpdaiqaglid ghitdtsyfagrdpafglianpvgawadpaqmidfvengggkelmnelinpyglqfigvs tpgleafvskvpldtvedlkgvkvrspeglianvfaaaganpvnlpssevytsldkgvid aadysvfsvnqdtgmndiaphpvypgfhslplvevsmnkqkwdaltpelqakiteaqkif qqtqidtlhqrdleaveaakaggkitvhdwsdeerakfrgiargewekvagqsemaqkvy dtlvtylkdkglmae
Timeline for d4pe3a_: