Lineage for d1axja_ (1axj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127290Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1127291Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1127292Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1127299Protein FMN-binding protein [50477] (1 species)
  7. 1127300Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (10 PDB entries)
  8. 1127323Domain d1axja_: 1axj A: [25749]
    complexed with fmn

Details for d1axja_

PDB Entry: 1axj (more details)

PDB Description: fmn-binding protein from desulfovibrio vulgaris (miyazaki f), nmr, 20 structures
PDB Compounds: (A:) fmn-binding protein

SCOPe Domain Sequences for d1axja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axja_ b.45.1.1 (A:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOPe Domain Coordinates for d1axja_:

Click to download the PDB-style file with coordinates for d1axja_.
(The format of our PDB-style files is described here.)

Timeline for d1axja_: