Lineage for d1axja_ (1axj A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670002Protein FMN-binding protein [50477] (1 species)
  7. 670003Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (5 PDB entries)
  8. 670014Domain d1axja_: 1axj A: [25749]
    complexed with fmn

Details for d1axja_

PDB Entry: 1axj (more details)

PDB Description: fmn-binding protein from desulfovibrio vulgaris (miyazaki f), nmr, 20 structures
PDB Compounds: (A:) fmn-binding protein

SCOP Domain Sequences for d1axja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axja_ b.45.1.1 (A:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOP Domain Coordinates for d1axja_:

Click to download the PDB-style file with coordinates for d1axja_.
(The format of our PDB-style files is described here.)

Timeline for d1axja_: