Lineage for d4pd4j_ (4pd4 J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740567Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (40 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 2740612Domain d4pd4j_: 4pd4 J: [257487]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4k_
    automated match to d3cx5j_
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4j_

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (J:) Igh protein

SCOPe Domain Sequences for d4pd4j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4j_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

SCOPe Domain Coordinates for d4pd4j_:

Click to download the PDB-style file with coordinates for d4pd4j_.
(The format of our PDB-style files is described here.)

Timeline for d4pd4j_: