Lineage for d4pdda_ (4pdd A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626547Species Polaromonas sp. [TaxId:296591] [257484] (2 PDB entries)
  8. 1626548Domain d4pdda_: 4pdd A: [257485]
    automated match to d4ovsa_
    complexed with eax, fmt, mla

Details for d4pdda_

PDB Entry: 4pdd (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4pdda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pdda_ c.94.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}
etilkigytppkdshygvgattfcdevekgtqerykcqhfpssalggeremiesvqlgtq
dlvntstgplgnfvpetrivdipflfrdyeharkvmdgaigqdllkkmqakgliglawte
ngfrhmtnskrpilqasdaaglkvrtmenkvhmdgyktfgllptpmafpelftalqqgtv
dgqenpipvilsskfsqvqkhlsltghvyspavlilssrvwdklseadkkvfvaaaqkat
vaqrkrvnddeangitqlkkdgmqvvekvdgesfrkavapayagfakefgaeriaaiqav
kae

SCOPe Domain Coordinates for d4pdda_:

Click to download the PDB-style file with coordinates for d4pdda_.
(The format of our PDB-style files is described here.)

Timeline for d4pdda_: