Lineage for d4pd4i_ (4pd4 I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631382Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2631383Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2631420Protein automated matches [190326] (4 species)
    not a true protein
  7. 2631423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (5 PDB entries)
  8. 2631432Domain d4pd4i_: 4pd4 I: [257482]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4j_, d4pd4k_
    automated match to d3cx5i_
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4i_

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (I:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d4pd4i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4i_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d4pd4i_:

Click to download the PDB-style file with coordinates for d4pd4i_.
(The format of our PDB-style files is described here.)

Timeline for d4pd4i_: