Lineage for d1flmb_ (1flm B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14785Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
  4. 14786Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
  5. 14787Family b.45.1.1: PNP-oxidase like [50476] (2 proteins)
  6. 14788Protein FMN-binding protein [50477] (1 species)
  7. 14789Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (2 PDB entries)
  8. 14791Domain d1flmb_: 1flm B: [25748]

Details for d1flmb_

PDB Entry: 1flm (more details), 1.3 Å

PDB Description: dimer of fmn-binding protein from desulfovibrio vulgaris (miyazaki f)

SCOP Domain Sequences for d1flmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flmb_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOP Domain Coordinates for d1flmb_:

Click to download the PDB-style file with coordinates for d1flmb_.
(The format of our PDB-style files is described here.)

Timeline for d1flmb_: