Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein automated matches [190874] (7 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [257477] (1 PDB entry) |
Domain d4pd4e2: 4pd4 E:87-215 [257478] Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d3cx5e1 complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4e2 b.33.1.1 (E:87-215) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye fdgdkvivg
Timeline for d4pd4e2: