SCOPe 2.08: Domain d4pd4e2: 4pd4 E:87-215

Lineage for d4pd4e2 (4pd4 E:87-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257477] (2 PDB entries)

8. Domain d4pd4e2: 4pd4 E:87-215 [257478]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d3cx5e1
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4e2

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d4pd4e2:

Sequence; same for both SEQRES and ATOM records:

>d4pd4e2 b.33.1.1 (E:87-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

Timeline for d4pd4e2:

• d4pd4e2 first appeared in SCOPe 2.04
  
• d4pd4e2 appears in SCOPe 2.07