Lineage for d4pd4e1 (4pd4 E:31-86)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631284Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2631285Protein automated matches [254432] (4 species)
    not a true protein
  7. 2631286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257475] (2 PDB entries)
  8. 2631289Domain d4pd4e1: 4pd4 E:31-86 [257476]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d3cx5e2
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4e1

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d4pd4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4e1 f.23.12.0 (E:31-86) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d4pd4e1:

Click to download the PDB-style file with coordinates for d4pd4e1.
(The format of our PDB-style files is described here.)

Timeline for d4pd4e1: