SCOPe 2.08: Domain d4pd4e1: 4pd4 E:31-86

Lineage for d4pd4e1 (4pd4 E:31-86)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257475] (2 PDB entries)

8. Domain d4pd4e1: 4pd4 E:31-86 [257476]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d3cx5e2
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4e1

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d4pd4e1:

Sequence; same for both SEQRES and ATOM records:

>d4pd4e1 f.23.12.0 (E:31-86) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

Timeline for d4pd4e1:

• d4pd4e1 first appeared in SCOPe 2.04
  
• d4pd4e1 appears in SCOPe 2.07