Lineage for d4pd4d2 (4pd4 D:261-309)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631158Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2631203Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2631204Protein automated matches [232791] (3 species)
    not a true protein
  7. 2631205Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257473] (2 PDB entries)
  8. 2631208Domain d4pd4d2: 4pd4 D:261-309 [257474]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d2ibzd2
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4d2

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d4pd4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4d2 f.23.11.0 (D:261-309) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk

SCOPe Domain Coordinates for d4pd4d2:

Click to download the PDB-style file with coordinates for d4pd4d2.
(The format of our PDB-style files is described here.)

Timeline for d4pd4d2: