SCOPe 2.06: Domain d4pd4d1: 4pd4 D:62-260

Lineage for d4pd4d1 (4pd4 D:62-260)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257471] (1 PDB entry)

8. Domain d4pd4d1: 4pd4 D:62-260 [257472]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d3cx5d1
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4d1

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d4pd4d1:

Sequence; same for both SEQRES and ATOM records:

>d4pd4d1 a.3.1.3 (D:62-260) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

Timeline for d4pd4d1:

• d4pd4d1 first appeared in SCOPe 2.04
  
• d4pd4d1 appears in SCOPe 2.05
  
• d4pd4d1 appears in SCOPe 2.07
  
• d4pd4d1 appears in the current release, SCOPe 2.08