| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.0: automated matches [254197] (1 protein) not a true family |
| Protein automated matches [254431] (4 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [257469] (1 PDB entry) |
| Domain d4pd4c2: 4pd4 C:262-385 [257470] Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d1kb9c1 complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4c2 f.32.1.0 (C:262-385) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk
Timeline for d4pd4c2: