![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Species Saccharomyces cerevisiae [TaxId:559292] [257462] (1 PDB entry) |
![]() | Domain d4pd4b1: 4pd4 B:17-218 [257465] Other proteins in same PDB: d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d3cx5b1 complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4b1 d.185.1.1 (B:17-218) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead lkrfvdesllstlpagkslvsk
Timeline for d4pd4b1: