SCOPe 2.07: Domain d4pd4a2: 4pd4 A:240-457

Lineage for d4pd4a2 (4pd4 A:240-457)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein automated matches [254430] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257462] (3 PDB entries)

8. Domain d4pd4a2: 4pd4 A:240-457 [257464]
   Other proteins in same PDB: d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d3cx5a2
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4a2

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (A:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d4pd4a2:

Sequence; same for both SEQRES and ATOM records:

>d4pd4a2 d.185.1.1 (A:240-457) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kkaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqg
iklldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvt
dteveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvk
awagkrlwdqdiaiagtgqieglldymrirsdmsmmrw

Timeline for d4pd4a2:

• d4pd4a2 first appeared in SCOPe 2.04
  
• d4pd4a2 appears in SCOPe 2.06
  
• d4pd4a2 appears in the current release, SCOPe 2.08