![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Anaplasma phagocytophilum [TaxId:1217107] [257458] (2 PDB entries) |
![]() | Domain d4pcaa1: 4pca A:1-218 [257459] Other proteins in same PDB: d4pcaa2, d4pcab2, d4pcac2, d4pcad2 automated match to d4oa8a_ complexed with edo, mn, sah |
PDB Entry: 4pca (more details), 1.5 Å
SCOPe Domain Sequences for d4pcaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pcaa1 c.66.1.0 (A:1-218) automated matches {Anaplasma phagocytophilum [TaxId: 1217107]} mrnvslskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsi vevgtcvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaq lntlkemapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvs snahasmrafndelankekylstiiptsegmmvsiklt
Timeline for d4pcaa1: