Lineage for d4pbqb_ (4pbq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145818Species Haemophilus influenzae [TaxId:656912] [257455] (1 PDB entry)
  8. 2145820Domain d4pbqb_: 4pbq B: [257457]
    automated match to d4ovsa_
    complexed with 2uf, mes, peg, so4

Details for d4pbqb_

PDB Entry: 4pbq (more details), 1.65 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from haemophilus influenzae rdaw (hicg_00826, target efi-510123) with bound l-gulonate
PDB Compounds: (B:) Putative TRAP PERIPLASMIC SOLUTE BINDING PROTEIN

SCOPe Domain Sequences for d4pbqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbqb_ c.94.1.0 (B:) automated matches {Haemophilus influenzae [TaxId: 656912]}
ktiiklghynsdihpshialqeyfkktienetnhkyeirlypnnqlggedqivnglrngt
ieagitglllqnvdpifgvwewpylfkdnqeakkvlespiankigqkmekygikllaygm
ngfrvissnkklekfddfkglrlrvplnslfvdwakamninpqsmplsevftaleqkvid
gqenpymlikdsglyevqkyiiqsnhifspgllqislktwnkipkedqiifekaaklyqe
kewelaiktelevkdylakhgneiivpseafkndmvnaskvlydsfykkydwakdvvqki
neak

SCOPe Domain Coordinates for d4pbqb_:

Click to download the PDB-style file with coordinates for d4pbqb_.
(The format of our PDB-style files is described here.)

Timeline for d4pbqb_: