SCOPe 2.04: Domain d4p9hc2: 4p9h C:98-177

Lineage for d4p9hc2 (4p9h C:98-177)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)

8. Domain d4p9hc2: 4p9h C:98-177 [257450]
   Other proteins in same PDB: d4p9hc1, d4p9hl1, d4p9hl2
   automated match to d3o2da2
   complexed with bam, epe, nag

Details for d4p9hc2

PDB Entry: 4p9h, 3 Å

PDB Description: crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv- 1 and soluble cd4 d1d2

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4p9hc2:

Sequence, based on SEQRES records:

>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvl

Sequence, based on observed residues (ATOM records):

>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdqsltltlesppgsspsvqcrsprgkniqggktlsvsqldsgtwtctvlqnqk
kvefkidivvl

Timeline for d4p9hc2:

• d4p9hc2 is new in SCOPe 2.04-stable
  
• d4p9hc2 appears in SCOPe 2.05
  
• d4p9hc2 appears in the current release, SCOPe 2.08