Lineage for d4p9hc2 (4p9h C:98-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753476Protein CD4 C2-set domains [49149] (2 species)
  7. 2753477Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
  8. 2753499Domain d4p9hc2: 4p9h C:98-177 [257450]
    Other proteins in same PDB: d4p9hc1, d4p9hl1, d4p9hl2
    automated match to d3o2da2
    complexed with bam, epe, nag

Details for d4p9hc2

PDB Entry: 4p9h (more details), 3 Å

PDB Description: crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv- 1 and soluble cd4 d1d2
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4p9hc2:

Sequence, based on SEQRES records: (download)

>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvl

Sequence, based on observed residues (ATOM records): (download)

>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdqsltltlesppgsspsvqcrsprgkniqggktlsvsqldsgtwtctvlqnqk
kvefkidivvl

SCOPe Domain Coordinates for d4p9hc2:

Click to download the PDB-style file with coordinates for d4p9hc2.
(The format of our PDB-style files is described here.)

Timeline for d4p9hc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p9hc1