![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d4p9hc2: 4p9h C:98-177 [257450] Other proteins in same PDB: d4p9hc1, d4p9hl1, d4p9hl2 automated match to d3o2da2 complexed with bam, epe, nag |
PDB Entry: 4p9h (more details), 3 Å
SCOPe Domain Sequences for d4p9hc2:
Sequence, based on SEQRES records: (download)
>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvl
>d4p9hc2 b.1.1.3 (C:98-177) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdqsltltlesppgsspsvqcrsprgkniqggktlsvsqldsgtwtctvlqnqk kvefkidivvl
Timeline for d4p9hc2: