SCOPe 2.08: Domain d4p9hc1: 4p9h C:2-97

Lineage for d4p9hc1 (4p9h C:2-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)

8. Domain d4p9hc1: 4p9h C:2-97 [257449]
   Other proteins in same PDB: d4p9hc2, d4p9hl1, d4p9hl2
   automated match to d2nxyb1
   complexed with bam, epe, nag

Details for d4p9hc1

PDB Entry: 4p9h, 3 Å

PDB Description: crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv- 1 and soluble cd4 d1d2

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4p9hc1:

Sequence; same for both SEQRES and ATOM records:

>d4p9hc1 b.1.1.1 (C:2-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrsl
wdqgnfpliiknltiedsdtyicevedqkeevqllv

Timeline for d4p9hc1:

• d4p9hc1 first appeared in SCOPe 2.04
  
• d4p9hc1 appears in SCOPe 2.07