SCOPe 2.06: Domain d4p91a_: 4p91 A:

Lineage for d4p91a_ (4p91 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (11 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [238487] (2 PDB entries)

8. Domain d4p91a_: 4p91 A: [257448]
   automated match to d4p8sa_
   complexed with nag

Details for d4p91a_

PDB Entry: 4p91, 2.1 Å

PDB Description: crystal structure of the nogo-receptor-2 (27-330)

PDB Compounds: (A:) Reticulon-4 receptor-like 2

SCOPe Domain Sequences for d4p91a_:

Sequence; same for both SEQRES and ATOM records:

>d4p91a_ c.10.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqacpppt

Timeline for d4p91a_:

• d4p91a_ first appeared in SCOPe 2.04
  
• d4p91a_ appears in SCOPe 2.05
  
• d4p91a_ appears in SCOPe 2.07
  
• d4p91a_ appears in the current release, SCOPe 2.08