Lineage for d1d2ed2 (1d2e D:349-451)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952593Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952594Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 952595Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 952623Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 952624Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (2 PDB entries)
    Uniprot P49410 56-452
  8. 952628Domain d1d2ed2: 1d2e D:349-451 [25744]
    Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3
    protein/RNA complex; complexed with gdp, mg

Details for d1d2ed2

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp
PDB Compounds: (D:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1d2ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ed2 b.44.1.1 (D:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw

SCOPe Domain Coordinates for d1d2ed2:

Click to download the PDB-style file with coordinates for d1d2ed2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ed2: