![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein automated matches [190251] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [257424] (2 PDB entries) |
![]() | Domain d4p7fa_: 4p7f A: [257437] automated match to d3u81a_ complexed with na, pi, po4 |
PDB Entry: 4p7f (more details), 1.37 Å
SCOPe Domain Sequences for d4p7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p7fa_ c.66.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gtkeqrilrhvqqhakpgdpqsvleaidtycsekewamnvgdakgqimdavireyrpslv lelgaycgysavrmarllppgarlltmeinpdyaaitqqmldfaglqdkvsiligapqdl ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekavyqgp
Timeline for d4p7fa_: