SCOPe 2.07: Domain d4p6zs_: 4p6z S:

Lineage for d4p6zs_ (4p6z S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.0: automated matches [257432] (1 protein)
   not a true family

6. Protein automated matches [257433] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [257434] (1 PDB entry)

8. Domain d4p6zs_: 4p6z S: [257435]
   Other proteins in same PDB: d4p6zb_
   automated match to d2vgls_

Details for d4p6zs_

PDB Entry: 4p6z, 3 Å

PDB Description: crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core

PDB Compounds: (S:) AP-1 complex subunit sigma-1A

SCOPe Domain Sequences for d4p6zs_:

Sequence; same for both SEQRES and ATOM records:

>d4p6zs_ d.110.4.0 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmrfmllfsrrgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
gdvqdtskksvlkaieqadllqeedes

Timeline for d4p6zs_:

• d4p6zs_ first appeared in SCOPe 2.04
  
• d4p6zs_ appears in SCOPe 2.06
  
• d4p6zs_ appears in the current release, SCOPe 2.08