Lineage for d4p6zs_ (4p6z S:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665855Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1665896Family d.110.4.0: automated matches [257432] (1 protein)
    not a true family
  6. 1665897Protein automated matches [257433] (1 species)
    not a true protein
  7. 1665898Species Homo sapiens [TaxId:9606] [257434] (1 PDB entry)
  8. 1665899Domain d4p6zs_: 4p6z S: [257435]
    Other proteins in same PDB: d4p6zb_
    automated match to d2vgls_

Details for d4p6zs_

PDB Entry: 4p6z (more details), 3 Å

PDB Description: crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
PDB Compounds: (S:) AP-1 complex subunit sigma-1A

SCOPe Domain Sequences for d4p6zs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p6zs_ d.110.4.0 (S:) automated matches {Homo sapiens [TaxId: 9606]}
mmrfmllfsrrgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
gdvqdtskksvlkaieqadllqeedes

SCOPe Domain Coordinates for d4p6zs_:

Click to download the PDB-style file with coordinates for d4p6zs_.
(The format of our PDB-style files is described here.)

Timeline for d4p6zs_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4p6zb_