Lineage for d4p6zb_ (4p6z B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006697Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2006704Protein automated matches [190425] (2 species)
    not a true protein
  7. 2006705Species Human (Homo sapiens) [TaxId:9606] [187313] (3 PDB entries)
  8. 2006709Domain d4p6zb_: 4p6z B: [257431]
    Other proteins in same PDB: d4p6zs_
    automated match to d2vglb_

Details for d4p6zb_

PDB Entry: 4p6z (more details), 3 Å

PDB Description: crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
PDB Compounds: (B:) AP-1 complex subunit beta-1

SCOPe Domain Sequences for d4p6zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p6zb_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtdnlelkklvylyl
mnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkiteylceplrkclkde
dpyvrktaavcvaklhdinaqlvedqgfldtlkdlisdsnpmvvanavaalseiaeshps
snlldlnpqsinklltalnectewgqifildclanympkddreaqsicervtprlshans
avvlsavkvlmkfmemlskdldyygtllkklapplvtllsaepelqyvalrninlivqkr
peilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvdfvrka
vraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesviaalc
enldsldepearaamiwivgeyaeridnadellesflegfhdkstqvqlqlltaivklfl
kkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpliseetd
lieptlldelicyigtlasvyhkppsafve

SCOPe Domain Coordinates for d4p6zb_:

Click to download the PDB-style file with coordinates for d4p6zb_.
(The format of our PDB-style files is described here.)

Timeline for d4p6zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4p6zs_