Lineage for d4p48a2 (4p48 A:129-252)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true protein
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) 
Domain d4p48a2: 4p48 A:129-252 [257427]
automated match to d4ouoa2
Details for d4p48a2
PDB Entry: 4p48 (more details), 1.35 Å
PDB Description: the structure of a chicken anti-cardiac troponin i scfv
PDB Compounds: (A:) Antibody scFv 180SCOPe Domain Sequences for d4p48a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p48a2 b.1.1.0 (A:129-252) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
altldesggglqtpggalslvckasgftfssygmqwvrqapgkglewvagiqnddtgtyy
gaavkgratisrdngqstvrlqlnnlraedtgtyycakdassdggyggdsidawghgtev
ivss
SCOPe Domain Coordinates for d4p48a2:
Click to download the PDB-style file with coordinates for d4p48a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4p48a2:
- d4p48a2 first appeared in SCOPe 2.04
- d4p48a2 appears in SCOPe 2.07
View in 3D
