SCOPe 2.04: Domain d4p48a1: 4p48 A:1-110

Lineage for d4p48a1 (4p48 A:1-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (16 PDB entries)

8. Domain d4p48a1: 4p48 A:1-110 [257426]
   automated match to d4ouoa1

Details for d4p48a1

PDB Entry: 4p48, 1.35 Å

PDB Description: the structure of a chicken anti-cardiac troponin i scfv

PDB Compounds: (A:) Antibody scFv 180

SCOPe Domain Sequences for d4p48a1:

Sequence; same for both SEQRES and ATOM records:

>d4p48a1 b.1.1.0 (A:1-110) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
altqpssvsanpggtveitcsgggryydgsyyygwyqqkspgsapvtviyentkrpsnip
srfsgsksgstatltitgvraedeavyycgsaddnmnptifgagttltvl

Timeline for d4p48a1:

• d4p48a1 is new in SCOPe 2.04-stable
  
• d4p48a1 appears in SCOPe 2.05
  
• d4p48a1 appears in the current release, SCOPe 2.08