Lineage for d4p58a_ (4p58 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611697Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1611723Protein automated matches [190251] (4 species)
    not a true protein
  7. 1611734Species Mus musculus [TaxId:10090] [257424] (2 PDB entries)
  8. 1611736Domain d4p58a_: 4p58 A: [257425]
    automated match to d3hvia_
    complexed with 2f6

Details for d4p58a_

PDB Entry: 4p58 (more details), 2.06 Å

PDB Description: Crystal structure of mouse comt bound to an inhibitor
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4p58a_:

Sequence, based on SEQRES records: (download)

>d4p58a_ c.66.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
tkeqrilryvqqnakpgdpqsvleaidtycsekewamnvgdakgqimdavireyspslvl
elgaycgysavrmarllqpgarlltmeinpdyaaitqqmlnfaglqdkvtiligasqdli
pqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflayv
rgsssfecthyssyleymkvvdglekaiyqgp

Sequence, based on observed residues (ATOM records): (download)

>d4p58a_ c.66.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
tkeqrilryvqqnakpgdpqsvleaidtycsegdakgqimdavireyspslvlelgaycg
ysavrmarllqpgarlltmeinpdyaaitqqmlnfaglqdkvtiligasqdlipqlkkky
dvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflayvrgsssfe
cthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d4p58a_:

Click to download the PDB-style file with coordinates for d4p58a_.
(The format of our PDB-style files is described here.)

Timeline for d4p58a_: