| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (120 species) not a true protein |
| Species Ochrobactrum anthropi [TaxId:439375] [257422] (2 PDB entries) |
| Domain d4p47a_: 4p47 A: [257423] automated match to d4n6ka_ |
PDB Entry: 4p47 (more details), 1.3 Å
SCOPe Domain Sequences for d4p47a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p47a_ c.94.1.0 (A:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
eirsqtikfaaanskghpqvtgmekfaelvkeksggqinvklfpggvlgsdpqtlsglqg
gvvemtvmnagilsstvkafeavdlpflfnsgeeadkvmdgpfgtnlmkrlpdtgligla
ywelgfrnltnnrhpvaklediaglkirtlqspvpvalfnalganavplpytelytalet
gtvdgqenpnaniinakfyevqkyltltrhqynpqivmiskkfwdrlndeekavieqaav
eardyqrkvsreqdataldeikktgmqvteltpeettrlrdavkpiidkftaeigaetvd
elfaelkkvrgenaenlyfq
Timeline for d4p47a_: