SCOPe 2.06: Domain d4p46d2: 4p46 D:95-192

Lineage for d4p46d2 (4p46 D:95-192)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d4p46d2: 4p46 D:95-192 [257421]
Other proteins in same PDB: d4p46a1, d4p46a2, d4p46b1, d4p46b2, d4p46c1, d4p46c2, d4p46d1
automated match to d1lnub1

Details for d4p46d2

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: j809.b5 y31a tcr bound to iab3k

PDB Compounds: (D:) 3K Peptide,H-2 class II histocompatibility antigen, A beta chain

SCOPe Domain Sequences for d4p46d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p46d2 b.1.1.2 (D:95-192) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewraq

SCOPe Domain Coordinates for d4p46d2:

Click to download the PDB-style file with coordinates for d4p46d2.
(The format of our PDB-style files is described here.)

Timeline for d4p46d2: