Lineage for d4p46d1 (4p46 D:-25-94)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163749Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2163831Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (6 PDB entries)
  8. 2163839Domain d4p46d1: 4p46 D:-25-94 [257420]
    Other proteins in same PDB: d4p46a1, d4p46a2, d4p46b1, d4p46b2, d4p46c1, d4p46c2, d4p46d2
    automated match to d1lnub2

Details for d4p46d1

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: J809.B5 Y31A TCR bound to IAb3K
PDB Compounds: (D:) 3K Peptide,H-2 class II histocompatibility antigen, A beta chain

SCOPe Domain Sequences for d4p46d1:

Sequence, based on SEQRES records: (download)

>d4p46d1 d.19.1.1 (D:-25-94) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

Sequence, based on observed residues (ATOM records): (download)

>d4p46d1 d.19.1.1 (D:-25-94) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravte
lgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOPe Domain Coordinates for d4p46d1:

Click to download the PDB-style file with coordinates for d4p46d1.
(The format of our PDB-style files is described here.)

Timeline for d4p46d1: