Lineage for d4p41b_ (4p41 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672779Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672780Species Human (Homo sapiens) [TaxId:9606] [88860] (13 PDB entries)
  8. 1672793Domain d4p41b_: 4p41 B: [257419]
    Other proteins in same PDB: d4p41a1, d4p41a2
    automated match to d1blxa_
    complexed with 24v

Details for d4p41b_

PDB Entry: 4p41 (more details), 2.9 Å

PDB Description: Crystal structure of a CDK6/Vcyclin complex with inhibitor bound
PDB Compounds: (B:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d4p41b_:

Sequence, based on SEQRES records: (download)

>d4p41b_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
cvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhletfehp
nvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgld
flhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqs
syatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalprqaf
hsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle

Sequence, based on observed residues (ATOM records): (download)

>d4p41b_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
cvaeigekvfkardlkngrfvalkrvrvegmplstirevavlrhletfehpnvvrlfdvc
ttkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqn
ilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifa
emfrrkplfrgssdvdqlgkildviglpgeedwppiekfdidelgkdlllkcltfnpakr
isaysalshpyfqdle

SCOPe Domain Coordinates for d4p41b_:

Click to download the PDB-style file with coordinates for d4p41b_.
(The format of our PDB-style files is described here.)

Timeline for d4p41b_:

  • d4p41b_ is new in SCOPe 2.04-stable
  • d4p41b_ does not appear in SCOPe 2.05