SCOPe 2.04: Domain d4p46c2: 4p46 C:82-178

Lineage for d4p46c2 (4p46 C:82-178)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (25 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d4p46c2: 4p46 C:82-178 [257418]
Other proteins in same PDB: d4p46a1, d4p46a2, d4p46b1, d4p46b2, d4p46c1, d4p46d1, d4p46d2
automated match to d1k2da1

Details for d4p46c2

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: j809.b5 y31a tcr bound to iab3k

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d4p46c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p46c2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhw

SCOPe Domain Coordinates for d4p46c2:

Click to download the PDB-style file with coordinates for d4p46c2.
(The format of our PDB-style files is described here.)

Timeline for d4p46c2: