Lineage for d4p46c1 (4p46 C:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938324Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. 2938336Domain d4p46c1: 4p46 C:0-81 [257417]
    Other proteins in same PDB: d4p46a1, d4p46a2, d4p46b1, d4p46b2, d4p46c2, d4p46d1, d4p46d2
    automated match to d2pxyc2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d4p46c1

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: j809.b5 y31a tcr bound to iab3k
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d4p46c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p46c1 d.19.1.1 (C:0-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOPe Domain Coordinates for d4p46c1:

Click to download the PDB-style file with coordinates for d4p46c1.
(The format of our PDB-style files is described here.)

Timeline for d4p46c1: