![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries) |
![]() | Domain d4p46c1: 4p46 C:0-81 [257417] Other proteins in same PDB: d4p46a1, d4p46a2, d4p46b1, d4p46b2, d4p46c2, d4p46d1, d4p46d2 automated match to d2pxyc2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 4p46 (more details), 2.85 Å
SCOPe Domain Sequences for d4p46c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p46c1 d.19.1.1 (C:0-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg lqniavvkhnlgvltkrsnstp
Timeline for d4p46c1: