Lineage for d4p46b2 (4p46 B:112-238)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2354344Domain d4p46b2: 4p46 B:112-238 [257416]
    Other proteins in same PDB: d4p46a1, d4p46b1, d4p46c1, d4p46c2, d4p46d1, d4p46d2
    automated match to d4dzbb2

Details for d4p46b2

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: j809.b5 y31a tcr bound to iab3k
PDB Compounds: (B:) J809.B5 TCR beta chain (Vb8.2)

SCOPe Domain Sequences for d4p46b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p46b2 b.1.1.2 (B:112-238) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d4p46b2:

Click to download the PDB-style file with coordinates for d4p46b2.
(The format of our PDB-style files is described here.)

Timeline for d4p46b2: