SCOPe 2.07: Domain d4p3ya1: 4p3y A:9-205

Lineage for d4p3ya1 (4p3y A:9-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries)

8. Domain d4p3ya1: 4p3y A:9-205 [257408]
   Other proteins in same PDB: d4p3ya2, d4p3ya3, d4p3yb1, d4p3yb2
   automated match to d1d8ta3
   complexed with gdp, gol, mg

Details for d4p3ya1

PDB Entry: 4p3y, 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya1:

Sequence; same for both SEQRES and ATOM records:

>d4p3ya1 c.37.1.8 (A:9-205) automated matches {Escherichia coli [TaxId: 469008]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Timeline for d4p3ya1:

• d4p3ya1 first appeared in SCOPe 2.04
  
• d4p3ya1 appears in SCOPe 2.06
  
• d4p3ya1 appears in the current release, SCOPe 2.08