| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:509173] [257404] (1 PDB entry) |
| Domain d4p3yb1: 4p3y B:5-182 [257405] Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3ya3, d4p3yb2 automated match to d4k2da_ complexed with gdp, gol, mg |
PDB Entry: 4p3y (more details), 2.15 Å
SCOPe Domain Sequences for d4p3yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3yb1 c.47.1.0 (B:5-182) automated matches {Acinetobacter baumannii [TaxId: 509173]}
agkdytvianpgkvevpgkievreffwygcphcfklephmqtwlkqipsdvrfvrtpaam
nkvweqgartyytsealgvrkrthlplfhaiqvngqqifdqasaakfftrygvpeqkfns
tynsfavtakvaesnklaqqyqltgvpavvvngkyvvqgedgkvtqvlnyliekerka
Timeline for d4p3yb1: