Lineage for d4p3yb1 (4p3y B:5-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2878969Species Acinetobacter baumannii [TaxId:509173] [257404] (1 PDB entry)
  8. 2878970Domain d4p3yb1: 4p3y B:5-182 [257405]
    Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3ya3, d4p3yb2
    automated match to d4k2da_
    complexed with gdp, gol, mg

Details for d4p3yb1

PDB Entry: 4p3y (more details), 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu
PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4p3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3yb1 c.47.1.0 (B:5-182) automated matches {Acinetobacter baumannii [TaxId: 509173]}
agkdytvianpgkvevpgkievreffwygcphcfklephmqtwlkqipsdvrfvrtpaam
nkvweqgartyytsealgvrkrthlplfhaiqvngqqifdqasaakfftrygvpeqkfns
tynsfavtakvaesnklaqqyqltgvpavvvngkyvvqgedgkvtqvlnyliekerka

SCOPe Domain Coordinates for d4p3yb1:

Click to download the PDB-style file with coordinates for d4p3yb1.
(The format of our PDB-style files is described here.)

Timeline for d4p3yb1: