SCOPe 2.08: Domain d4p3ba1: 4p3b A:679-745

Lineage for d4p3ba1 (4p3b A:679-745)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein automated matches [257397] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries)

8. Domain d4p3ba1: 4p3b A:679-745 [257401]
   Other proteins in same PDB: d4p3ba2, d4p3bb2, d4p3bc2, d4p3bd2
   automated match to d1kjsa_
   complexed with fmt

Details for d4p3ba1

PDB Entry: 4p3b, 2.1 Å

PDB Description: crystal structure of the mouse c5a-desarg anaphylatoxin

PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d4p3ba1:

Sequence; same for both SEQRES and ATOM records:

>d4p3ba1 a.50.1.1 (A:679-745) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafneccti
ankirke

Timeline for d4p3ba1:

• d4p3ba1 first appeared in SCOPe 2.04, called d4p3ba_
  
• d4p3ba1 appears in SCOPe 2.07