![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) ![]() |
![]() | Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
![]() | Protein C5a anaphylotoxin [47688] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
![]() | Domain d4p39a1: 4p39 A:678-745 [257396] Other proteins in same PDB: d4p39a2, d4p39b2 automated match to d1cfaa_ |
PDB Entry: 4p39 (more details), 2.4 Å
SCOPe Domain Sequences for d4p39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p39a1 a.50.1.1 (A:678-745) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]} tlqkkieeiaakykhsvvkkccydgarvnndetceqraarislgprcikafteccvvasq lranisfk
Timeline for d4p39a1:
![]() Domains from other chains: (mouse over for more information) d4p39b1, d4p39b2, d4p39c_, d4p39d_ |