Lineage for d4p39a1 (4p39 A:678-745)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327856Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327857Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2327858Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2327862Protein C5a anaphylotoxin [47688] (2 species)
  7. 2327863Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2327864Domain d4p39a1: 4p39 A:678-745 [257396]
    Other proteins in same PDB: d4p39a2, d4p39b2
    automated match to d1cfaa_

Details for d4p39a1

PDB Entry: 4p39 (more details), 2.4 Å

PDB Description: crystal structure of the human c5ar antagonist c5a-a8
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d4p39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p39a1 a.50.1.1 (A:678-745) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
tlqkkieeiaakykhsvvkkccydgarvnndetceqraarislgprcikafteccvvasq
lranisfk

SCOPe Domain Coordinates for d4p39a1:

Click to download the PDB-style file with coordinates for d4p39a1.
(The format of our PDB-style files is described here.)

Timeline for d4p39a1: