Lineage for d1aipe2 (1aip E:313-405)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [50470] (4 PDB entries)
  8. 1544820Domain d1aipe2: 1aip E:313-405 [25739]
    Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipe2

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (E:) elongation factor tu

SCOPe Domain Sequences for d1aipe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipe2 b.44.1.1 (E:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1aipe2:

Click to download the PDB-style file with coordinates for d1aipe2.
(The format of our PDB-style files is described here.)

Timeline for d1aipe2: