SCOP 1.59: Domain d1aipb2: 1aip B:313-405

Lineage for d1aipb2 (1aip B:313-405)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)

4. Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family)

5. Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50470] (3 PDB entries)

8. Domain d1aipb2: 1aip B:313-405 [25738]
   Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipb2

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipb2:

Sequence; same for both SEQRES and ATOM records:

>d1aipb2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1aipb2:

• d1aipb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aipb2 appears in SCOP 1.57
  
• d1aipb2 appears in SCOP 1.61
  
• d1aipb2 appears in the current release, SCOPe 2.08