SCOPe 2.04: Domain d4p0ca_: 4p0c A:

Lineage for d4p0ca_ (4p0c A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [257378] (2 PDB entries)

8. Domain d4p0ca_: 4p0c A: [257379]
   automated match to d2ocsa_
   complexed with cl, scn

Details for d4p0ca_

PDB Entry: 4p0c, 1.34 Å

PDB Description: crystal structure of nherf2 pdz1 domain in complex with lpa2

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein

SCOPe Domain Sequences for d4p0ca_:

Sequence; same for both SEQRES and ATOM records:

>d4p0ca_ b.36.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
mprlcrlvrgeqgygfhlhgekgrrgqfirrvepgspaeaaalragdrlvevngvnvege
thhqvvqrikavegqtrllvvdqmdstl

Timeline for d4p0ca_:

• d4p0ca_ is new in SCOPe 2.04-stable
  
• d4p0ca_ appears in SCOPe 2.05
  
• d4p0ca_ appears in the current release, SCOPe 2.08, called d4p0ca1