Lineage for d4p0ca_ (4p0c A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379982Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)
  8. 2379991Domain d4p0ca_: 4p0c A: [257379]
    automated match to d2ocsa_
    complexed with cl, scn

Details for d4p0ca_

PDB Entry: 4p0c (more details), 1.34 Å

PDB Description: crystal structure of nherf2 pdz1 domain in complex with lpa2
PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein

SCOPe Domain Sequences for d4p0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p0ca_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mprlcrlvrgeqgygfhlhgekgrrgqfirrvepgspaeaaalragdrlvevngvnvege
thhqvvqrikavegqtrllvvdqmdstl

SCOPe Domain Coordinates for d4p0ca_:

Click to download the PDB-style file with coordinates for d4p0ca_.
(The format of our PDB-style files is described here.)

Timeline for d4p0ca_: