SCOPe 2.07: Domain d4ozhf2: 4ozh F:129-256

Lineage for d4ozhf2 (4ozh F:129-256)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4ozhf2: 4ozh F:129-256 [257376]
   Other proteins in same PDB: d4ozha1, d4ozhb1, d4ozhb2, d4ozhc1, d4ozhd1, d4ozhd2, d4ozhe1, d4ozhf1, d4ozhg1, d4ozhh1
   automated match to d2esve2
   complexed with ca, nag

Details for d4ozhf2

PDB Entry: 4ozh, 2.8 Å

PDB Description: s16 protein complex

PDB Compounds: (F:) T-cell receptor, s16, beta chain

SCOPe Domain Sequences for d4ozhf2:

Sequence; same for both SEQRES and ATOM records:

>d4ozhf2 b.1.1.2 (F:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4ozhf2:

• d4ozhf2 first appeared in SCOPe 2.04
  
• d4ozhf2 appears in SCOPe 2.06
  
• d4ozhf2 appears in the current release, SCOPe 2.08