Lineage for d4ozhh1 (4ozh H:3-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757677Domain d4ozhh1: 4ozh H:3-128 [257375]
    Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhe1, d4ozhe2, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh2
    automated match to d2ak4e1
    complexed with ca, nag

Details for d4ozhh1

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex
PDB Compounds: (H:) T-cell receptor, s16, beta chain

SCOPe Domain Sequences for d4ozhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozhh1 b.1.1.0 (H:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvle

SCOPe Domain Coordinates for d4ozhh1:

Click to download the PDB-style file with coordinates for d4ozhh1.
(The format of our PDB-style files is described here.)

Timeline for d4ozhh1: