| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4ozhf1: 4ozh F:3-128 [257374] Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhe1, d4ozhe2, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh2 automated match to d2ak4e1 complexed with ca, nag |
PDB Entry: 4ozh (more details), 2.8 Å
SCOPe Domain Sequences for d4ozhf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozhf1 b.1.1.0 (F:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvle
Timeline for d4ozhf1: