SCOPe 2.08: Domain d4ozhf1: 4ozh F:3-128

Lineage for d4ozhf1 (4ozh F:3-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ozhf1: 4ozh F:3-128 [257374]
   Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhe1, d4ozhe2, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh2
   automated match to d2ak4e1
   complexed with ca, nag

Details for d4ozhf1

PDB Entry: 4ozh, 2.8 Å

PDB Description: s16 protein complex

PDB Compounds: (F:) T-cell receptor, s16, beta chain

SCOPe Domain Sequences for d4ozhf1:

Sequence; same for both SEQRES and ATOM records:

>d4ozhf1 b.1.1.0 (F:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvle

Timeline for d4ozhf1:

• d4ozhf1 first appeared in SCOPe 2.04
  
• d4ozhf1 appears in SCOPe 2.07