Lineage for d4ozhe1 (4ozh E:2-129)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512993Domain d4ozhe1: 4ozh E:2-129 [257372]
    Other proteins in same PDB: d4ozhe2, d4ozhf1, d4ozhf2, d4ozhh1, d4ozhh2
    automated match to d2esvd1
    complexed with ca, nag

Details for d4ozhe1

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex
PDB Compounds: (E:) T-cell receptor, s16, alpha chain

SCOPe Domain Sequences for d4ozhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozhe1 b.1.1.1 (E:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpn

SCOPe Domain Coordinates for d4ozhe1:

Click to download the PDB-style file with coordinates for d4ozhe1.
(The format of our PDB-style files is described here.)

Timeline for d4ozhe1: